About

Emily Taylor Thomas! Sixteen<3 THS cheer!:] Tahitian Dancing. Competition; its not a hobby its a life style..<3 Live&Love life like there's no tomorrow:] Cheerleader from bow to toe<3

Search keywords

Following

shearsundancemomsdramareallyghettoph143dancemomsimacheerleadertaramiyaasunsetsoverthepacificmickeyandminniecourtlynnesimplyjunedancemomslust-after-lovesimpledisneythingskaiitm2-headedgirlcartacacoethesgeepamlizspeakskkrristinasincerelybrookemariedbss11cindysawwatergabrielleerin0027laneahiromibbrianaaagswilliamsdaanieeesiiimplyyymeeekayyytdessyannxoxoknotblondebeebsterbrownarieeexoxoheynessaathe-hobo-on-your-streetreinadreamdancemomsmiamia-crown-of-thornsi-fly-with-the-stars-in-the-skyyreinasamonethefiercestwear-bowsshit-thatblowswild-young-thangtatatatatatacosjennamarblescheerpluslifefuckyeah-hairxoxorachelrae07myaaaabeeee5landsharkingbryanjorrelwhetsellpretzelvanamamakrissteenmariiejkohichineeeeekyshit-i-hatemeliabbytwlohamiirbabywe-dream-in-colormarcostaysfr3shrobbystanovichjustman7kailie-nicolereembabejessicakisingmanders9brown-eyes-wide-shutcurlyhairandbowshannahlee2teradatildasammieebaabyjasmineeeetawaangellicaanisssaaajackieoseomaurinefuentesemmaleeelainemaaduhhlynnkaylaaabooabsoluute-truthhailybloooorhiannonmaeeeaustinmmmgoodjessickaraeugly-barbieesmileysarah3ameliaaikogabebroloveitmokarlariosmiosxobabygotbackxoblondieandblueyessimplyfredocolette13dufffyjforjavvijoyceminafyeahcapturedwithaclickhell-rcthomas3mattykinslovesmepsychologicalfacts

Liked posts

See more stuff I like

Follow me

↓ Navigate ↓

HAR?

themed by Cherrie H.

It goes a little something like this

Last day of school:

  • Everyone else:  I'm gonna miss everyone so much!
  • Me:  Fuck you all, I'm out bitches!

Source: causeimfabulous

30th May 2012 (10:31 am) - Reblogged from I'm not like a regular blog, I'm a cool blog

I need to go to bed

But I just wanna dance

30th May 2012 (2:24 am) - By emilytaylorrrr

I gotta practice what I preach..

It will all be okay in the end. If its not okay, then it’s not the end.

30th May 2012 (2:10 am) - By emilytaylorrrr

Dear mom,

*cough cough* I’m sick I can’t go to school tomorrow. -__-
More like sick to my stomach. Why do I feel like this.:/

30th May 2012 (2:09 am) - By emilytaylorrrr

This is how i’ve felt all week.

(via lizspeaks)

30th May 2012 (2:07 am) - Reblogged from WORTHLESS

Sitting fighting with myself

Lol I have a busy life….

30th May 2012 (1:37 am) - By emilytaylorrrr

Something to live by.

Source: just-red

Something to live by.

(via cindysawwater)

30th May 2012 (1:35 am) - Reblogged from Just Red.

Oh my goshhhh!

That turn sequence was flawlesssss!❤

30th May 2012 (1:12 am) - By emilytaylorrrr

That one really hurt

30th May 2012 (1:01 am) - By emilytaylorrrr

cindysawwater:

kopwdjibhs :3

Source: johnnyhatesyou

cindysawwater:

kopwdjibhs :3

30th May 2012 (12:34 am) - Reblogged from omniscience

Maybe the first one.

Source: little-blackbook

Maybe the first one.

(via kayyyt)

30th May 2012 (12:24 am) - Reblogged from Little Black Book

Source: partywithasinner

(via beebsterbrown)

30th May 2012 (12:22 am) - Reblogged from This mess thats devoured me.